PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G02522.1.p
Common NameEUGRSUZ_G02522
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 469aa    MW: 52367.5 Da    PI: 6.1573
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G02522.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.86e-142569348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       W+++Ed++l + ++ +G+++W  Ia+++   +t+ qc+ rw++yl
  Eucgr.G02522.1.p 25 TWSQQEDDILREQITIHGTDNWVIIASKFK-DKTARQCRRRWYTYL 69
                      6****************************9.*************97 PP

2Myb_DNA-binding42.31.7e-1375118146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g W++eEd ll +a k +G++ W+ I++ +  gRt++ +k+r+ +
  Eucgr.G02522.1.p  75 KGGWSPEEDTLLCEAQKIFGNR-WTEISKVVA-GRTDNAVKNRFTT 118
                       688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.011869IPR017930Myb domain
SMARTSM007175.3E-132271IPR001005SANT/Myb domain
CDDcd001671.51E-122569No hitNo description
Gene3DG3DSA:1.10.10.605.5E-192676IPR009057Homeodomain-like
PfamPF139211.2E-132686No hitNo description
SuperFamilySSF466892.21E-2548131IPR009057Homeodomain-like
PROSITE profilePS5129420.28870124IPR017930Myb domain
SMARTSM007176.7E-1574122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-1977123IPR009057Homeodomain-like
CDDcd001676.18E-1178119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MQEMKRKVDG SGNNGDVKKE RHIVTWSQQE DDILREQITI HGTDNWVIIA SKFKDKTARQ  60
CRRRWYTYLN SDFKKGGWSP EEDTLLCEAQ KIFGNRWTEI SKVVAGRTDN AVKNRFTTLC  120
KKRAKYEALT KENNFAFINT NNKRVISYNT SILEETSESA VHTKRLSRRT QVPDLIEACN  180
IGERSYGKCR VAFPPQQPRT PFSVVVSNIH NNYAAKDSKN ERTFLSKDDP KATALMQQAE  240
LLGSLALKVN TESTCQSLEN AWKVLEDFLS QAKGGELHEH KTSNIDFQQE NFKDLLKELE  300
SSIDGSQSSR EPDLCETSPA SSDYSTGSTI LLHGTTDGTE PTRQRGGILD EYIETETAAP  360
PIHTEQLVND QNVAQLFHAT TDQENLQSID EQINESGVGP APSHTEFGSP LEVTPLFGSL  420
AAGIPSPKFS ESEKNFIMKT LGMESPCPIP SINPSHPPAC KRALLQNP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-262612410108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G02522.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066938.10.0PREDICTED: uncharacterized protein LOC104453968 isoform X2
TrEMBLA0A059BH480.0A0A059BH48_EUCGR; Uncharacterized protein
STRINGPOPTR_0010s10310.11e-172(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-157myb domain protein 88